PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G105200.1
Common NamePHAVU_006G105200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 216aa    MW: 24104.2 Da    PI: 8.9661
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G105200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.6e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT eEd++lv  ++++G g+W++ ++  g+ R++k+c++rw +yl
  Phvul.006G105200.1 14 KGPWTVEEDQILVSHIQRYGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                        79******************************99************97 PP

2Myb_DNA-binding543.9e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++++eE++ ++++++ lG++ W++Ia  ++ gRt++++k++w+++l
  Phvul.006G105200.1  67 RGKFSKEEEDTILELHEILGNR-WSAIATSLP-GRTDNEIKNFWHTHL 112
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.584961IPR017930Myb domain
SuperFamilySSF466893.09E-3110108IPR009057Homeodomain-like
SMARTSM007179.8E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-151461IPR001005SANT/Myb domain
CDDcd001672.79E-111661No hitNo description
PROSITE profilePS5129426.07662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002494.3E-1667112IPR001005SANT/Myb domain
CDDcd001672.72E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MMKTPCCERM GLKKGPWTVE EDQILVSHIQ RYGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGKF SKEEEDTILE LHEILGNRWS AIATSLPGRT DNEIKNFWHT HLKKRVQRGG  120
VHLNGNASSH ILQEAQPNGS SSSSDASSVY GNVMLANYGL PSRKNPINPP IVGAGFYGAV  180
SSDTFGETVD NHGSCQLSEE MEFWYNIFIK SGQTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
1h8a_C3e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-155AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147213.11e-162hypothetical protein PHAVU_006G105200g
SwissprotQ7XBH46e-74MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLV7BMN81e-162V7BMN8_PHAVU; Uncharacterized protein
STRINGGLYMA19G43740.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.15e-70myb domain protein 15